Summary
Resource Type
mRNA- polypeptide
Organism
Name
Fraxinus_pennsylvanica_120313_comp100093_c0_seq1
Identifier
Fraxinus_pennsylvanica_120313_comp100093_c0_seq1
Analyses
Time Last Modified
Saturday, December 14, 2019 - 14:58
Annotations
This record has the following annotations.
TermNameDefinition
INTERPRO:IPR008889VQ
Publication
  1. Lane T, Best T, Zembower N, Davitt J, Henry N, Xu Y, Koch J, Liang H, McGraw J, Schuster S, Shim D. The green ash transcriptome and identification of genes responding to abiotic and biotic stresses. BMC genomics. 2016 Dec;17(1):702. ─ More info
  2. Lane T, Best T, Zembower N, Davitt J, Henry N, Xu Y, Koch J, Liang H, McGraw J, Schuster S, Shim D. The green ash transcriptome and identification of genes responding to abiotic and biotic stresses. BMC genomics. 2016 Dec;17(1):702. ─ More info
Relationship
There is 1 relationship.
Relationship
The polypeptide, Fraxinus_pennsylvanica_120313_comp100093_c0_seq1_m.67338, derives from mRNA, Fraxinus_pennsylvanica_120313_comp100093_c0_seq1.
Sequences
mRNA Sequence
TGATTTCACATGCATGAAGTAGTTAAATATATATAATCCATCAGAACCAT
CCGAAAATCATAAACAGTAATTAAGTACTACAACATGTACAAAACTTGAA
GGAGAGAAATCATAATAAGTATTAATTGTTACACAATTAAAAGGGATCTT
GGCGCTGGAACTGTTGATGCTGGTTGTTGTAAAAATATTGCTGATCTTGC
GCCTTATAACTCCGGCCAGAAACGAACTCCAATGGATTATTTCTTGTGGA
AATTAGACCATTGAGCTGCTGATGATCAGTAGCTGATGATGAGGAGGATC
CAAAACACAAAGTGATCGGCCCTCTCTGAGTGTGGCTGCAACCGGTGTGT
TTTTGCACTAGGGATCTAAAATTTGTTATGTGGGCATTCAGATAAGTCGT
CGGAGTTAGCCTCGAAGCTCTGGACCGCCTCCGTTTTGGAGTCCCCGGAC
TGGTTTTCGTCTTCAAATCACTCCCAGCTGTTGAACTTGAATTTTCTGGG
CTGTTACTTGTAACCACTACACTGTAATCAGGGTTGAATAGGTTTTCGTT
TATATCGAAATTAGTAGTTGACACCATCGTTGCATCGGAAAATTCGGGAC
AAGGCATGAAAAAGTCATCAATTAATATTGGTTCTTGGTAGTATTGTTCC
CACGGAGAAGAGCTTGGGACATGGTCACTCATGGTGGCTTTCGGTGGGTG
TTTTCTATAGCACTCCCTCTTAGCCCTTTTTAGCCTCTGATCATAGGAAG
AATACAACACCCTTTGCTAAAAACACACTCATATATATAGCGACAATCAA
TCAGAATAACAGGTTCCGATTTTCAAACCAGTCATGTCGCGTGCTTGCTG
ACCAGACCATTCATGTCATTGATATATATTTATAC
Sequence Length
885
Protein Sequence
MSDHVPSSSPWEQYYQEPILIDDFFMPCPEFSDATMVSTTNFDINENLFN
PDYSVVVTSNSPENSSSTAGSDLKTKTSPGTPKRRRSRASRLTPTTYLNA
HITNFRSLVQKHTGCSHTQRGPITLCFGSSSSSATDHQQLNGLISTRNNP
LEFVSGRSYKAQDQQYFYNNQHQQFQRQDPF*
InterProScan
The following InterPro results are available for this feature:
Analysis Name: Fraxinus pennsylvanica - peptides InterProScan
Date Performed: 2016-04-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008889VQPFAMPF05678VQcoord: 94..114
e-value: 1.4E-4
score: 20.7

Homology (BLAST)

Click a tab below to view blast alignments.

Expression

Available Analyses

Select an Expression Analysis

Select a property to group and sort biological samples

Select a property to color biological samples

Hover the mouse over a column in the graph to view more information about that biological sample. You can click and drag to rearrange groups along the x-axis. You can also click and drag to move the legend.

Only Non-Zero Values | Reset

Download expression dataset for this feature
JBrowse

The Green ash (F. pennsylvanica) transcriptome was mapped to the European ash (F. excelsior) genome assembly using GMAP.

Total F. pennsylvanica mrna contigs Contigs mapped to F. excelsior >90% identity >90% coverage
107,611 102,977 80,940 75,379

Reference: Thomas D. Wu and Colin K. Watanabe. GMAP: a genomic mapping and alignment program for mRNA and EST sequences. Bioinformatics 2005 21:1859-1875

Go to JBrowse

Give Feedback!